PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK09435.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 145aa    MW: 17154.6 Da    PI: 5.6733
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK09435.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.42.5e-1172113346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rW++ + el+++av+q G++ ++ I + ++ +Rt++q+k+++ k
        PK09435.2  72 RWSKNDTELFYEAVRQIGTD-FTIIQQLFP-NRTREQVKLKFKK 113
                      9*******************.*********.**********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159636.2E-2863131No hitNo description
PROSITE profilePS512939.44968116IPR017884SANT domain
SMARTSM007176.0E-869117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-670113IPR009057Homeodomain-like
SuperFamilySSF466892.84E-1171119IPR009057Homeodomain-like
CDDcd001679.85E-772113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
XIKDAAKLKT EQTNQSTEDN FREDVSHNEE MFHSEQGEQG QNSDDNQPTY RAQPSSTYVN  60
YHSFMDRTPS TRWSKNDTEL FYEAVRQIGT DFTIIQQLFP NRTREQVKLK FKKEERQHPL  120
RLSDALTNRT KGEEILIYCA SLYFM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010105352.14e-46Transcription factor TFIIIB component B''
TrEMBLW9RZ724e-46W9RZ72_9R
STRINGVIT_03s0038g04460.t013e-37(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36662938
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.24e-29MYB_related family protein